PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 441aa    MW: 48583.2 Da    PI: 7.4775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628008.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-182976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l d+++++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_009628008.1 29 KGPWTKEEDAILMDYIRKHGEGNWSAVQKHSGLARCGKSCRLRWANHL 76
                     79******************************************9986 PP

2Myb_DNA-binding40.47e-1382125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ T+eE   + ++++++G++ W+ Ia++++ gRt++++k++w++
   XP_009628008.1  82 KGALTPEEVRHINELHAKMGNK-WAQIAAKLP-GRTDNEIKNYWNT 125
                      6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.9612480IPR017930Myb domain
SuperFamilySSF466899.18E-3026123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-242779IPR009057Homeodomain-like
SMARTSM007171.0E-142878IPR001005SANT/Myb domain
PfamPF002494.0E-162976IPR001005SANT/Myb domain
CDDcd001671.44E-123176No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2380130IPR009057Homeodomain-like
PROSITE profilePS5129419.11381131IPR017930Myb domain
SMARTSM007178.9E-1281129IPR001005SANT/Myb domain
PfamPF002498.2E-1282125IPR001005SANT/Myb domain
CDDcd001674.29E-986125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MTSKVGVDSP SVEEASGGGS TRGGVPLKKG PWTKEEDAIL MDYIRKHGEG NWSAVQKHSG  60
LARCGKSCRL RWANHLRPDL KKGALTPEEV RHINELHAKM GNKWAQIAAK LPGRTDNEIK  120
NYWNTRIKKR QRAGLQIYPP DISFQAFSEN KQNKELGIFS SANSHPDFLP INGFTIPTVE  180
FKKLEPSQLL YPRALLNIAA SSFFDIPATS LLAQGLSSSN TCSGLSTMHP SKRIRGSESW  240
FFGLNDDLFQ ACHQYQNDGS LLAQSLGFSS SYTHNLTSDH HPSFSVEIPG SHAPLNGNSS  300
SSEPKWAKKL ELPSLQIQME NWGSPSPLPS LESFDTLIQS PPNEHADSGS LSPRNSGLLD  360
AVLYESQTSK ASKNNSHQET SCDVDDSYPD LQETQWGRYS DPISPLGHSA ASVLSKYTPM  420
EVHWMSPPVN SDGGWLSRRL T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31241301107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628008.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_009628009.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_016444814.10.0PREDICTED: transcription factor GAMYB-like, partial
TrEMBLA1Z3690.0A1Z369_SOLLC; GAMYB-like2
STRINGSolyc06g073640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-84myb domain protein 65